Antibodies
Rabbit polyclonal antibody to MMP2 | |
---|---|
![]() |
Function: Metalloproteinase 2 is a 72kDa enzyme involved in remodeling of the vasculature, invasion of tumors and degrading extracellular matrix proteins. Its C-terminal does not have a catalytic function and have anti-tumor activity. Cane be detected extracellularly, in cytoplasm and cell nuclei. MMP2 is present in many tumors including breast and prostate cancer. |
Formulation | Lyophilized powder |
Purification | Affinity purified |
Host Species | Rabbit |
Unit Size: | 100 µg |
Immunogen | Synthetic peptide |
Sequence: | AWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWL |
Alternative Names | 72 kDa gelatinase, Gelatinase A |
Accession Number: | P08253 |
Gene Symbol | MMP2 |
Accession URL: | http://www.uniprot.org/uniprot/P08253 |
Applications: | Immunohistochemistry (IHC), Immunocytochemistry (ICC), Western Blotting (WB). |
Working Dilution for Immunofluorescence (ICC): | 5 – 15 µg/mL |
Working Dilution for Immunohistochemistry (IHC): | 5 – 10 µg/mL |
Working Dilution for Western Blottin (WB): | 1 µg/mL |
IHC Positive control: | Tumors of different origin |
Specificity: | Confirmed by WB. |
Reactivity: | Human |
Reconstitution: | Reconstitute in 0.05 mL of PBS (pH 7.4) to achieve an antibody concentration of 1000 µg/mL. Centrifuge to remove any insoluble material. |
Storage / Stability: | At least 12 months after purchase at 2 - 4°C. After reconstitution, aliquot and store at -20°C for a higher stability and at 4°C with an appropriate antibacterial agent. Avoid freeze-thaw cycles. |
References
|